PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.M6U8Q
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 680aa    MW: 74609 Da    PI: 6.1006
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.M6U8QgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.94.8e-28214267155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++F+ av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Araip.M6U8Q 214 KPRVVWSVELHQQFMAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 267
                  79*******************.********************************8 PP

2Response_reg77.25.8e-26381461109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l+   y ev+ ++ +e+alell+ ++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a + +  + + +  Ga 
   Araip.M6U8Q  38 VLVVDDDPTCLMILEKMLKACLY-EVTKCKCAEAALELLRGNKngFDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKHVVMKGVTHGAC 132
                   89*****************9999.***************777778**********************6654.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l +
   Araip.M6U8Q 133 DYLIKPVRIEALKN 146
                   **********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.9E-17714672IPR017053Response regulator B-type, plant
SuperFamilySSF521724.13E-3535156IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.6E-4135180No hitNo description
SMARTSM004486.0E-3136148IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.78737152IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.7E-2338146IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.21E-2839151No hitNo description
PROSITE profilePS5129410.888211270IPR017930Myb domain
SuperFamilySSF466895.2E-20211271IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-30213272IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-24214267IPR006447Myb domain, plants
PfamPF002492.4E-7216266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    Send to blast
MNLSNVKGST MSTPSSSGSH LRSTGDAVSD QFPAGLRVLV VDDDPTCLMI LEKMLKACLY  60
EVTKCKCAEA ALELLRGNKN GFDIVISDVH MPDMDGFKLL EHIGLEMDLP VIMMSADDGK  120
HVVMKGVTHG ACDYLIKPVR IEALKNIWQH VVRKRKTGWR DPEQSGSIDE GDRQQKVSDD  180
ADYSSSANEG KSSKKRRDEE EDADERDDSS TLKKPRVVWS VELHQQFMAA VNQLGIDKAV  240
PKKILELMNV PGLTRENVAS HLQKYRLYLR RLSGVSQQQN NLNNSFMNPQ DPTFGSTSIN  300
GIDLQALSVA GQLPAQSLAK LQAAGLGRST AKPVMSMPLV EQRNLFSFES PKLRFGEGQM  360
QHLNTNKPIN LLHGIPTNME PKQLANLHQS AQSLGNLNMR INASVAQRSP LLMQMGQSQP  420
RGQMIGENGS HVNQLPTSLL QPTVPNRISN GVIRNGIASS SNINAAYNQV PQSSSFLNFP  480
MNQTNEMSVR SFPLGSHPGI SNITTKGMLQ EEVTSGIKGS SGFVPNYDMF NELQPQKSQD  540
WDLTTAGLTY DATQHSNHVQ GNTDVSVSPS VLVHPGFTSI QQTGQNRDTT SSMGKDMFSI  600
GEGMDQGNLQ SISQPQNPLL IDNSVRVKAE RVPDASSQTN FFPEQYGQED LMSALLKQEG  660
IGLAENEFDF DGYSLDNIPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-22213273464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016197903.10.0PREDICTED: two-component response regulator ARR2-like
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLI1MGI90.0I1MGI9_SOYBN; Uncharacterized protein
STRINGGLYMA15G15520.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.10.0response regulator 2